PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.2633s0010.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family NAC
Protein Properties Length: 326aa    MW: 37476.7 Da    PI: 5.8418
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.2633s0010.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM174.23.7e-5471351128
                     NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvka...eekewyfFskrdkkyatgkrknratksgyWk 84 
                             +ppGfrFhPt+eelv +yLk+k++++k++l +vi+++d+yk+ePwd+++++k    e+kewyfFs++d+ky+tg+r+nrat++g+Wk
  SapurV1A.2633s0010.1.p   7 VPPGFRFHPTEEELVGYYLKRKIHSQKIDL-DVIANIDLYKMEPWDIQARCKLgydEQKEWYFFSHKDRKYPTGTRTNRATAAGFWK 92 
                             69****************************.9***************963333333777**************************** PP

                     NAM  85 atgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                             atg+dk+vls k++l+g++ktLvfykgrap+g+k+dW+mheyrl
  SapurV1A.2633s0010.1.p  93 ATGRDKAVLS-KNRLIGMRKTLVFYKGRAPNGRKSDWIMHEYRL 135
                             **********.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.09E-594156IPR003441NAC domain
PROSITE profilePS5100558.097156IPR003441NAC domain
PfamPF023651.5E-288135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 326 aa     Download sequence    Send to blast
MEMEPCVPPG FRFHPTEEEL VGYYLKRKIH SQKIDLDVIA NIDLYKMEPW DIQARCKLGY  60
DEQKEWYFFS HKDRKYPTGT RTNRATAAGF WKATGRDKAV LSKNRLIGMR KTLVFYKGRA  120
PNGRKSDWIM HEYRLQTSEL APPQEEGWVV CRAFMKPSPN QRQGFEAWSH AYCVNNIDHA  180
RPPPFSDTAT TAQNMVRPSQ EGASFQQPFG LNSDLVSIQT FLDNNNQLVE LPELDSPSTI  240
STSFAAKEGN FHQTNEDYDE ERSNNSSQFI DWKNFETLIA SQETDHSSST SYPLQNLSSM  300
PQNYDVAARQ QDQYVGHFPD CFPDL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A7e-51215610168Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB5999390.0AB599939.1 Populus trichocarpa PtVNS08 mRNA for transcription factor, complete cds.
GenBankHQ2158580.0HQ215858.1 Populus trichocarpa wood-associated NAC domain transcription factor 6B (WND6B) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011001778.10.0PREDICTED: NAC domain-containing protein 7-like isoform X2
RefseqXP_011001780.10.0PREDICTED: NAC domain-containing protein 7-like isoform X2
SwissprotQ9C8W91e-114NAC30_ARATH; NAC domain-containing protein 30
TrEMBLE5KUI20.0E5KUI2_POPTR; Transcription factor
STRINGPOPTR_0019s11330.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF71383247
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71930.11e-104vascular related NAC-domain protein 7